Ultraeq.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title Ultra Equipment | Health & Fitness and Entertainment & Lifestyle Solution Integrators
Description N/A
Keywords N/A
Server Information
WebSite ultraeq favicon www.ultraeq.com
Host IP 206.188.192.9
Location Jacksonville, Florida, United States
Related Websites
Site Rank
soundcreationsltd.com #5,030,582
electrohub.co.ke #2,901,012
More to Explore
unitedmonks.in
uklocksmithsassociation.co.uk
unitun.com
universite-du-vin.com
urbanguidequebec.com
utilitiestrainingcentre.co.uk
utic.com.tn
vashikaranspecialistankitsharma.wordpress.com
uttarakhandnidhi.in
velapos.com
myhindigrammar.com
myinfinitus.com
Ultraeq.com Valuation
US$8,122
Last updated: Feb 23, 2021

Ultraeq.com has global traffic rank of 4,174,489. Ultraeq.com has an estimated worth of US$ 8,122, based on its estimated Ads revenue. Ultraeq.com receives approximately 741 unique visitors each day. Its web server is located in Jacksonville, Florida, United States, with IP address 206.188.192.9. According to SiteAdvisor, ultraeq.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$8,122
Daily Ads Revenue US$4
Monthly Ads Revenue US$133
Yearly Ads Revenue US$1,624
Daily Unique Visitors 741
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 4,174,489
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
ultraeq.com A 7199 IP: 206.188.192.9
ultraeq.com MX 7199 Priority: 10
Target: mx1.netsolmail.net.
ultraeq.com NS 7199 Target: ns20.worldnic.com.
ultraeq.com NS 7199 Target: ns19.worldnic.com.
ultraeq.com SOA 7199 MNAME: NS19.WORLDNIC.com.
RNAME: namehost.WORLDNIC.com.
Serial: 120120303
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum TTL: 3600
HTTP Headers
HTTP/1.1 200 OK
Server: openresty/1.17.8.2
Date: Tue, 23 Feb 2021 02:22:16 GMT
Content-Type: text/html
Content-Length: 22975
Connection: keep-alive
Vary: Accept-Encoding
Last-Modified: Thu, 20 Aug 2020 10:24:24 GMT
ETag: "59bf-5ad4c863b3e47"
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: "1; mode=block"
Referrer-Policy: no-referrer-when-downgrade
X-Webcom-Cache-Status: BYPASS
Accept-Ranges: bytes

Ultraeq.com Whois Information
   Domain Name: ULTRAEQ.COM
   Registry Domain ID: 1627786899_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.networksolutions.com
   Registrar URL: http://networksolutions.com
   Updated Date: 2019-06-15T08:24:44Z
   Creation Date: 2010-11-29T06:21:13Z
   Registry Expiry Date: 2026-11-29T06:21:13Z
   Registrar: Network Solutions, LLC
   Registrar IANA ID: 2
   Registrar Abuse Contact Email: abuse@web.com
   Registrar Abuse Contact Phone: +1.8003337680
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: NS19.WORLDNIC.COM
   Name Server: NS20.WORLDNIC.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

IP Address Has Reached Rate Limit